ARF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179614

Catalog No. NBP179614

Description

ARF4 Polyclonal specifically detects ARF4 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ARF4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADP-ribosylation factor 4, ARF2ADP-ribosylation factor 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This antibody is predicted to react to human ARF1,3,4,5 (100% homology) and 6 (93%).
• Target Species: Mouse, Rat, Pig, Equine, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_031505
• Gene Symbols: ARF4
• Immunogen: Synthetic peptide directed towards the N terminal of human Arf4The immunogen for this antibody is Arf4. Peptide sequence VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 378
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.