Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ARF4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARF4 Polyclonal specifically detects ARF4 in Mouse samples. It is validated for Western Blot.Specifications
ARF4 | |
Polyclonal | |
Rabbit | |
NP_031505 | |
378 | |
Synthetic peptide directed towards the N terminal of human Arf4The immunogen for this antibody is Arf4. Peptide sequence VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ADP-ribosylation factor 4, ARF2ADP-ribosylation factor 2 | |
ARF4 | |
IgG | |
20 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title