ARFRP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214306

Catalog No. NBP214306

Description

ARFRP1 Polyclonal specifically detects ARFRP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ARFRP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20
• Gene Accession No.: Q13795
• Gene Symbols: ARFRP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10139
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ADP-ribosylation factor related protein 1, ARF-related protein 1, ARL18, ARP1, ARPADP-ribosylation factor-related protein 1, helicase-like protein NHL, SCG10 like-protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only