Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP154621

Arginase 1/ARG1/liver Arginase Antibody, Novus Biologicals™
SDP

Catalog No. NBP154621 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154621 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154621 Supplier Novus Biologicals Supplier No. NBP154621
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 5 publications

Arginase 1/ARG1/liver Arginase Polyclonal specifically detects Arginase 1/ARG1/liver Arginase in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Arginase 1/ARG1/liver Arginase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P05089
Gene Alias arginase 1, arginase, liver, arginase-1, EC 3.5.3.1, Liver-type arginase, Type I arginase
Gene Symbols ARG1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ARG1(arginase, liver) The peptide sequence was selected from the N terminal of ARG1 (NP_000036). Peptide sequence HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK.
Molecular Weight of Antigen 35 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Chromatin Research, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 383
Reconstitution Reconstitute with 100μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.