Argininosuccinate Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP188867

Catalog No. NBP188867

Description

Argininosuccinate Synthase Polyclonal specifically detects Argininosuccinate Synthase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Argininosuccinate Synthase
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: argininosuccinate synthase, argininosuccinate synthase 1, argininosuccinate synthetase, argininosuccinate synthetase 1, ASSCTLN1, citrulline-aspartate ligase, Citrulline--aspartate ligase, EC 6.3.4.5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 445
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ASS1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only