Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Argonaute 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Argonaute 3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Argonaute 3 Polyclonal specifically detects Argonaute 3 in Mouse samples. It is validated for Western Blot.Specifications
Argonaute 3 | |
Polyclonal | |
Rabbit | |
NP_700451 | |
192669 | |
IgG | |
97 kDa |
Western Blot | |
Unconjugated | |
RUO | |
AGO3argonaute 3, argonaute3, eIF2C 3, eIF-2C 3, Eukaryotic translation initiation factor 2C 3, eukaryotic translation initiation factor 2C, 3, FLJ12765, hAgo3, MGC86946, protein argonaute-3 | |
The specific Immunogen is proprietary information. Peptide sequence VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title