Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Argonaute 4 Antibody, Novus Biologicals™

Argonaute 4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155239 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155239 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155239 Supplier Novus Biologicals Supplier No. NBP155239
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Argonaute 4 Polyclonal specifically detects Argonaute 4 in Human samples. It is validated for Western Blot.

Specifications

Antigen Argonaute 4
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9HCK5
Gene Alias AGO4argonaute 4, Argonaute4, eIF2C 4, eIF-2C 4, Eukaryotic translation initiation factor 2C 4, eukaryotic translation initiation factor 2C, 4, FLJ20033, hAgo4, KIAA1567argonaute4, protein argonaute-4
Gene Symbols AGO4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to EIF2C4(eukaryotic translation initiation factor 2C, 4) The peptide sequence was selected from the middle region of EIF2C4 (NP_060099). Peptide sequence: DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR.
Molecular Weight of Antigen 97 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 192670
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Canine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.