ARHGAP20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25635525UL

Catalog No. NB394524

Description

ARHGAP20 Polyclonal specifically detects ARHGAP20 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ARHGAP20
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: KIAA1391Rho-type GTPase-activating protein 20, RA and RhoGAP domain containing protein, RARHOGAP, Rho GTPase activating protein 20, rho GTPase-activating protein 20
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ARHGAP20
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 57569
• Target Species: Human
• Form: Purified

For Research Use Only