Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ARHGEF19 Antibody, Novus Biologicals™

ARHGEF19 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15703820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15703820 20 μL
NBP157038 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15703820 Supplier Novus Biologicals Supplier No. NBP15703820UL

Description

Rabbit Polyclonal Antibody

ARHGEF19 Polyclonal specifically detects ARHGEF19 in Human samples. It is validated for Western Blot.

Specifications

Antigen ARHGEF19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IW93
Gene Alias ephexin-2, FLJ33962, Rho guanine nucleotide exchange factor (GEF) 19, RP4-733M16.1, weakly similar to Rho GEF, WGEFrho guanine nucleotide exchange factor 19
Gene Symbols ARHGEF19
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ARHGEF19 (Rho guanine nucleotide exchange factor (GEF) 19) The peptide sequence was selected from the middle region of ARHGEF19 (NP_694945). Peptide sequence: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS.
Molecular Weight of Antigen 89 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 128272
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.