Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ARHGEF7 Antibody, Novus Biologicals™

ARHGEF7 Antibody, Novus Biologicals™
SDP

Catalog No. NB431208 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB431208 25 μL
NBP188650 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB431208 Supplier Novus Biologicals Supplier No. NBP18865025UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ARHGEF7 Polyclonal specifically detects ARHGEF7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen ARHGEF7
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q14155
Gene Alias Beta-Pix, COOL1COOL-1, DKFZp686C12170, DKFZp761K1021, guanine nucleotide exchange factor 7, KIAA0142KIAA0412, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPRBETA-PIX, PAK3, PAK3BP, PIXBPAK-interacting exchange factor beta, Rho guanine nucleotide exchange factor (GEF) 7, rho guanine nucleotide exchange factor 7, SH3 domain-containing proline-rich protein
Gene Symbols ARHGEF7
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8874
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.