Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARID5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ARID5B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16916920
|
Novus Biologicals
NBP16916920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169169
|
Novus Biologicals
NBP169169 |
100 μL |
Each for $487.50
|
|
|||||
Description
ARID5B Polyclonal specifically detects ARID5B in Human samples. It is validated for Western Blot.Specifications
| ARID5B | |
| Polyclonal | |
| Rabbit | |
| Q14865 | |
| 84159 | |
| Synthetic peptides corresponding to ARID5B (AT rich interactive domain 5B (MRF1-like)) The peptide sequence was selected from the C terminal of ARID5B (NP_115575). Peptide sequence: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ARID domain-containing protein 5B, AT rich interactive domain 5B (MRF1-like), DESRTAT-rich interactive domain-containing protein 5B, FLJ21150, Modulator recognition factor 2, modulator recognition factor 2 (MRF2), MRF-2, MRF2MRF1-like protein | |
| ARID5B | |
| IgG | |
| 132 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title