Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ARID5B Antibody, Novus Biologicals™

ARID5B Antibody, Novus Biologicals™
SDP

Catalog No. NBP183622 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP183622 0.1 mL
NB418860 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP183622 Supplier Novus Biologicals Supplier No. NBP183622
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 4 publications

ARID5B Polyclonal specifically detects ARID5B in Human, Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen ARID5B
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Chromatin Immunoprecipitation (ChIP)
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ARID domain-containing protein 5B, AT rich interactive domain 5B (MRF1-like), DESRTAT-rich interactive domain-containing protein 5B, FLJ21150, Modulator recognition factor 2, modulator recognition factor 2 (MRF2), MRF-2, MRF2MRF1-like protein
Gene Symbols ARID5B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHHVRLENFRKME
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84159
Test Specificity Specificity of human ARID5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.