Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ARL13B Antibody, Novus Biologicals™

ARL13B Antibody, Novus Biologicals™
SDP

Catalog No. NBP15549820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15549820 20 μL
NBP155498 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15549820 Supplier Novus Biologicals Supplier No. NBP15549820UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

ARL13B Polyclonal specifically detects ARL13B in Human samples. It is validated for Western Blot.

Specifications

Antigen ARL13B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias ADP-ribosylation factor-like 13B, ADP-ribosylation factor-like 2-like 1, ADP-ribosylation factor-like protein 13B, ADP-ribosylation factor-like protein 2-like 1, ARL2L1MGC120611, ARL2-like protein 1, DKFZp686E2075, DKFZp686L2472, DKFZp761H079, JBTS8DKFZp686M2074, MGC120612
Gene Symbols ARL13B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ARL13B (ADP-ribosylation factor-like 13B) The peptide sequence was selected from the middle region of ARL13B. Peptide sequence RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR.
Molecular Weight of Antigen 37 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 200894
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.