Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARL14EP Antibody, Novus Biologicals™
SDP

Catalog No. NBP15647820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15647820 20 μL
NBP156478 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15647820 Supplier Novus Biologicals Supplier No. NBP15647820UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

ARL14EP Polyclonal specifically detects ARL14EP in Human samples. It is validated for Western Blot.

Specifications

Antigen C11orf46
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N8R7
Gene Alias ADP-ribosylation factor-like 14 effector protein, ARF7EP, C11orf46, chromosome 11 open reading frame 46, dJ299F11.1, FLJ38968, hypothetical protein LOC120534
Gene Symbols ARL14EP
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C11ORF46 The peptide sequence was selected from the N terminal of C11ORF46. Peptide sequence SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 120534
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.