Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARL14EP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15647820UL
Description
ARL14EP Polyclonal specifically detects ARL14EP in Human samples. It is validated for Western Blot.Specifications
C11orf46 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8N8R7 | |
ARL14EP | |
Synthetic peptides corresponding to C11ORF46 The peptide sequence was selected from the N terminal of C11ORF46. Peptide sequence SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ADP-ribosylation factor-like 14 effector protein, ARF7EP, C11orf46, chromosome 11 open reading frame 46, dJ299F11.1, FLJ38968, hypothetical protein LOC120534 | |
Rabbit | |
Affinity Purified | |
RUO | |
120534 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction