Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARL14EP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	C11orf46
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15647820 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15647820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP156478 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP156478	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ARL14EP Polyclonal specifically detects ARL14EP in Human samples. It is validated for Western Blot.

Specifications

Antigen	C11orf46
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q8N8R7
Gene ID (Entrez)	120534
Immunogen	Synthetic peptides corresponding to C11ORF46 The peptide sequence was selected from the N terminal of C11ORF46. Peptide sequence SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ADP-ribosylation factor-like 14 effector protein, ARF7EP, C11orf46, chromosome 11 open reading frame 46, dJ299F11.1, FLJ38968, hypothetical protein LOC120534
Gene Symbols	ARL14EP
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ARL14EP Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents