Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARL17 Antibody, Novus Biologicals™
SDP

Catalog No. NBP170420UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP170420UL 20 μL
NBP170411 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP170420UL Supplier Novus Biologicals Supplier No. NBP17041120UL

Rabbit Polyclonal Antibody

ARL17 Polyclonal specifically detects ARL17 in Human samples. It is validated for Western Blot.

Specifications

Antigen ARL17
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IVW1
Gene Alias ADP-ribosylation factor-like 17B, ADP-ribosylation factor-like protein 17, ADP-ribosylation factor-like protein 7, ARL17A, ARL17B
Gene Symbols ARL17B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ARL17(ADP-ribosylation factor-like 17) The peptide sequence was selected from the middle region of ARL17 (NP_001034172). Peptide sequence KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD.
Molecular Weight of Antigen 19 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 100506084
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.