Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARL17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | ARL17 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170420UL
![]() |
Novus Biologicals
NBP17041120UL |
20 μL |
Each for $206.00
|
|
|||||
NBP170411
![]() |
Novus Biologicals
NBP170411 |
100 μL |
Each for $499.50
|
|
|||||
Description
ARL17 Polyclonal specifically detects ARL17 in Human samples. It is validated for Western Blot.Specifications
ARL17 | |
Polyclonal | |
Rabbit | |
Human | |
ADP-ribosylation factor-like 17B, ADP-ribosylation factor-like protein 17, ADP-ribosylation factor-like protein 7, ARL17A, ARL17B | |
ARL17B | |
IgG | |
19 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8IVW1 | |
100506084 | |
Synthetic peptides corresponding to ARL17(ADP-ribosylation factor-like 17) The peptide sequence was selected from the middle region of ARL17 (NP_001034172). Peptide sequence KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title