Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARL17 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen ARL17
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP170420UL
View Documents
Novus Biologicals
NBP17041120UL
20 μL
Each for $152.22
Add to cart
 
NBP170411
View Documents
Novus Biologicals
NBP170411
100 μL
Each for $436.00
Add to cart
 
Description

Description

ARL17 Polyclonal specifically detects ARL17 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ARL17
Polyclonal
Rabbit
Human
Q8IVW1
100506084
Synthetic peptides corresponding to ARL17(ADP-ribosylation factor-like 17) The peptide sequence was selected from the middle region of ARL17 (NP_001034172). Peptide sequence KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
ADP-ribosylation factor-like 17B, ADP-ribosylation factor-like protein 17, ADP-ribosylation factor-like protein 7, ARL17A, ARL17B
ARL17B
IgG
Affinity Purified
19 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit