ARL8A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158860

Catalog No. NBP158860

Description

ARL8A Polyclonal specifically detects ARL8A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARL8A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADP-ribosylation factor-like 10B, ADP-ribosylation factor-like 8A, ADP-ribosylation factor-like protein 10B, ADP-ribosylation factor-like protein 8A, ARL10B, FLJ45195, GIE2, Novel small G protein indispensable for equal chromosome segregation 2, small G protein indispensable for equal chromosome segregation 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96BM9
• Gene Symbols: ARL8A
• Immunogen: Synthetic peptides corresponding to ARL8A(ADP-ribosylation factor-like 8A) The peptide sequence was selected from the middle region of ARL8A. Peptide sequence IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 127829
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.