Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARL8A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ARL8A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARL8A Polyclonal specifically detects ARL8A in Human samples. It is validated for Western Blot.Specifications
ARL8A | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
ADP-ribosylation factor-like 10B, ADP-ribosylation factor-like 8A, ADP-ribosylation factor-like protein 10B, ADP-ribosylation factor-like protein 8A, ARL10B, FLJ45195, GIE2, Novel small G protein indispensable for equal chromosome segregation 2, small G protein indispensable for equal chromosome segregation 2 | |
ARL8A | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q96BM9 | |
127829 | |
Synthetic peptides corresponding to ARL8A(ADP-ribosylation factor-like 8A) The peptide sequence was selected from the middle region of ARL8A. Peptide sequence IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title