Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ARL8B Antibody, Novus Biologicals™

ARL8B Antibody, Novus Biologicals™
SDP

Catalog No. NBP156544 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156544 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156544 Supplier Novus Biologicals Supplier No. NBP156544
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ARL8B Polyclonal specifically detects ARL8B in Human samples. It is validated for Western Blot.

Specifications

Antigen ARL8B
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NVJ2
Gene Alias ADP-ribosylation factor-like 10C, ADP-ribosylation factor-like 8B, ADP-ribosylation factor-like protein 10C, ADP-ribosylation factor-like protein 8B, ARL10C, FLJ10702, Gie1, Novel small G protein indispensable for equal chromosome segregation 1
Gene Symbols ARL8B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ARL8B(ADP-ribosylation factor-like 8B) The peptide sequence was selected from the middle region of ARL8B (NP_060654). Peptide sequence DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL.
Molecular Weight of Antigen 22 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 55207
Test Specificity Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92%.
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.