Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARNTL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$501.50
Specifications
Antigen | ARNTL2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP169002
![]() |
Novus Biologicals
NBP169002 |
100 μL |
Each for $501.50
|
|
|||||
NBP16900220
![]() |
Novus Biologicals
NBP16900220UL |
20 μL | N/A | N/A | N/A | ||||
Description
ARNTL2 Polyclonal specifically detects ARNTL2 in Mouse samples. It is validated for Western Blot.Specifications
ARNTL2 | |
Polyclonal | |
Rabbit | |
Q2VPD4 | |
56938 | |
The immunogen for anti-Arntl2 antibody: synthetic peptide corresponding to a region of Mouse ARNTL2 (NP_758513). Peptide sequence AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Aryl hydrocarbon receptor nuclear translocator-like protein 2, Basic-helix-loop-helix-PAS protein MOP9, bHLHe6, BMAL2, Brain and muscle ARNT-like 2, Class E basic helix-loop-helix protein 6, CLIF, CYCLE-like factor, Member of PAS protein 9, MOP9, PAS domain-containing protein 9, PASD9, Transcription Factor BMAL2 | |
ARNTL2 | |
IgG | |
64 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title