Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Arrestin 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Arrestin 3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16908320
|
Novus Biologicals
NBP16908320UL |
20 μL |
Each for $152.22
|
|
NBP169083
|
Novus Biologicals
NBP169083 |
100 μL |
Each for $436.00
|
|
Description
Arrestin 3 Polyclonal specifically detects Arrestin 3 in Human samples. It is validated for Western Blot.Specifications
Arrestin 3 | |
Polyclonal | |
Rabbit | |
Cell Biology, Cellular Markers, GPCR, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Virology Bacteria and Parasites, Vision | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
407 | |
Synthetic peptides corresponding to ARR3 (arrestin 3, retinal (X-arrestin)) The peptide sequence was selected from the middle region of ARR3. Peptide sequence EDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
arrestin 3, retinal (X-arrestin), arrestin 4, arrestin-C, ARRXcArr, CAR, C-arrestin, Cone arrestin, Retinal cone arrestin-3, X-arrestin | |
ARR3 | |
IgG | |
Affinity Purified | |
43 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title