Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Arrestin 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Arrestin 3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16908320
View Documents
Novus Biologicals
NBP16908320UL
20 μL
Each for $152.22
Add to cart
 
NBP169083
View Documents
Novus Biologicals
NBP169083
100 μL
Each for $436.00
Add to cart
 
Description

Description

Arrestin 3 Polyclonal specifically detects Arrestin 3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Arrestin 3
Polyclonal
Rabbit
Cell Biology, Cellular Markers, GPCR, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Virology Bacteria and Parasites, Vision
PBS and 2% Sucrose with 0.09% Sodium Azide
407
Synthetic peptides corresponding to ARR3 (arrestin 3, retinal (X-arrestin)) The peptide sequence was selected from the middle region of ARR3. Peptide sequence EDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
Human
arrestin 3, retinal (X-arrestin), arrestin 4, arrestin-C, ARRXcArr, CAR, C-arrestin, Cone arrestin, Retinal cone arrestin-3, X-arrestin
ARR3
IgG
Affinity Purified
43 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit