ASB6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158945

Catalog No. NBP158945

Description

ASB6 Polyclonal specifically detects ASB6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ASB6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ankyrin repeat and SOCS box containing 6, ankyrin repeat and SOCS box protein 6, ankyrin repeat and SOCS box-containing 6, ASB-6, FLJ20548, MGC1024
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Equine: 92%; Pig: 92%; Xenopus: 83%; Chicken: 83%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NWX5
• Gene Symbols: ASB6
• Immunogen: Synthetic peptides corresponding to ASB6(ankyrin repeat and SOCS box-containing 6) The peptide sequence was selected from the middle region of ASB6. Peptide sequence LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 140459
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.