Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASB6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ASB6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15894520
|
Novus Biologicals
NBP15894520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP158945
|
Novus Biologicals
NBP158945 |
100 μL |
Each for $487.50
|
|
|||||
Description
ASB6 Polyclonal specifically detects ASB6 in Human samples. It is validated for Western Blot.Specifications
| ASB6 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| ankyrin repeat and SOCS box containing 6, ankyrin repeat and SOCS box protein 6, ankyrin repeat and SOCS box-containing 6, ASB-6, FLJ20548, MGC1024 | |
| ASB6 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NWX5 | |
| 140459 | |
| Synthetic peptides corresponding to ASB6(ankyrin repeat and SOCS box-containing 6) The peptide sequence was selected from the middle region of ASB6. Peptide sequence LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title