Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASB7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15759920UL
Description
ASB7 Polyclonal specifically detects ASB7 in Human samples. It is validated for Western Blot.Specifications
ASB7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9H672 | |
ASB7 | |
Synthetic peptides corresponding to ASB7 (ankyrin repeat and SOCS box-containing 7) The peptide sequence was selected from the middle region of ASB7)(50ug). Peptide sequence QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC. | |
20 μL | |
Signal Transduction | |
140460 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ankyrin repeat and SOCS box containing 7, ankyrin repeat and SOCS box protein 7, ankyrin repeat and SOCS box-containing 7, ASB-7, FLJ22551, FLJ25192 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction