Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ASB8 Antibody, Novus Biologicals™

ASB8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15890420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15890420 20 μL
NBP158904 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15890420 Supplier Novus Biologicals Supplier No. NBP15890420UL

Description

Rabbit Polyclonal Antibody

ASB8 Polyclonal specifically detects ASB8 in Human samples. It is validated for Western Blot.

Specifications

Antigen ASB8
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H765
Gene Alias ankyrin repeat and SOCS box containing 8, ankyrin repeat and SOCS box protein 8, ankyrin repeat and SOCS box-containing 8, ASB-8, FLJ21255, MGC5540
Gene Symbols ASB8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ASB8(ankyrin repeat and SOCS box-containing 8) The peptide sequence was selected from the N terminal of ASB8. Peptide sequence MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 140461
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.