ASCL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169172

Catalog No. NBP169172

Description

ASCL3 Polyclonal specifically detects ASCL3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ASCL3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: achaete-scute complex homolog 3 (Drosophila), ASH-3, bHLH transcription factor Sgn-1 (Salivary Glands 1), bHLH transcriptional regulator Sgn-1, BHLHA42, bHLHa42achaete-scute homolog 3, Class A basic helix-loop-helix protein 42, hASH3, HASH3achaete-scute complex (Drosophila) homolog-like 3, SGN1
• Host Species: Rabbit
• Molecular Weight of Antigen: 21 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NQ33
• Gene Symbols: ASCL3
• Immunogen: Synthetic peptides corresponding to ASCL3 (achaete-scute complex homolog 3 (Drosophila)) The peptide sequence was selected from the C terminal of ASCL3. Peptide sequence PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56676
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG