Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASCL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ASCL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ASCL3 Polyclonal specifically detects ASCL3 in Human samples. It is validated for Western Blot.Specifications
| ASCL3 | |
| Polyclonal | |
| Rabbit | |
| Q9NQ33 | |
| 56676 | |
| Synthetic peptides corresponding to ASCL3 (achaete-scute complex homolog 3 (Drosophila)) The peptide sequence was selected from the C terminal of ASCL3. Peptide sequence PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| achaete-scute complex homolog 3 (Drosophila), ASH-3, bHLH transcription factor Sgn-1 (Salivary Glands 1), bHLH transcriptional regulator Sgn-1, BHLHA42, bHLHa42achaete-scute homolog 3, Class A basic helix-loop-helix protein 42, hASH3, HASH3achaete-scute complex (Drosophila) homolog-like 3, SGN1 | |
| ASCL3 | |
| IgG | |
| 21 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title