Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ASF1b Antibody, Novus Biologicals™

ASF1b Antibody, Novus Biologicals™
SDP

Catalog No. NBP152947 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP152947 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP152947 Supplier Novus Biologicals Supplier No. NBP152947
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ASF1b Polyclonal specifically detects ASF1b in Human samples. It is validated for Western Blot.

Specifications

Antigen ASF1b
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NVP2
Gene Alias ASF1 silencing function 1 homolog B (S. cerevisiae), CCG1-interacting factor A-II, CIA-II, FLJ10604, hAsf1, hAsf1b, hCIA-II, histone chaperone ASF1B, silencing function protein 1 homolog B
Gene Symbols ASF1B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ASF1B(ASF1 anti-silencing function 1 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of ASF1B. Peptide sequence YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 55723
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Rabbit: 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.