ASF1b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152947

Catalog No. NBP152947

Description

ASF1b Polyclonal specifically detects ASF1b in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ASF1b
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ASF1 silencing function 1 homolog B (S. cerevisiae), CCG1-interacting factor A-II, CIA-II, FLJ10604, hAsf1, hAsf1b, hCIA-II, histone chaperone ASF1B, silencing function protein 1 homolog B
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Rabbit: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NVP2
• Gene Symbols: ASF1B
• Immunogen: Synthetic peptides corresponding to ASF1B(ASF1 anti-silencing function 1 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of ASF1B. Peptide sequence YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH.
• Quantity: 100 μL
• Research Discipline: Cancer, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 55723
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.