Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASF1b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ASF1b |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ASF1b Polyclonal specifically detects ASF1b in Human samples. It is validated for Western Blot.Specifications
ASF1b | |
Polyclonal | |
Rabbit | |
Q9NVP2 | |
55723 | |
Synthetic peptides corresponding to ASF1B(ASF1 anti-silencing function 1 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of ASF1B. Peptide sequence YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ASF1 silencing function 1 homolog B (S. cerevisiae), CCG1-interacting factor A-II, CIA-II, FLJ10604, hAsf1, hAsf1b, hCIA-II, histone chaperone ASF1B, silencing function protein 1 homolog B | |
ASF1B | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title