Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ASGPR1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154385 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154385 100 μL
NBP15438520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP154385 Supplier Novus Biologicals Supplier No. NBP154385
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ASGPR1 Polyclonal specifically detects ASGPR1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ASGPR1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6FGQ5
Gene Alias ASGPR, ASGPR 1, ASGP-R 1, asialoglycoprotein receptor 1, CLEC4H1ASGPR1, C-type lectin domain family 4 member H1, Hepatic lectin H1, HL-1
Gene Symbols ASGR1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middlel region of human ASGPR1. Peptide Sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS. The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 33 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Immunology, Virology Bacteria and Parasites
Primary or Secondary Primary
Gene ID (Entrez) 432
Test Specificity Equine: 86%; Yeast: 75%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Yeast
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.