Asialoglycoprotein Receptor 2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP154888	100 μL

Catalog No. NBP154888 Supplier Novus Biologicals Supplier No. NBP154888

Description

Rabbit Polyclonal Antibody

Asialoglycoprotein Receptor 2 Polyclonal specifically detects Asialoglycoprotein Receptor 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Asialoglycoprotein Receptor 2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 1 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10 - 1:500, Immunohistochemistry-Paraffin 1:10 - 1:500
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P07307
• Gene Alias: ASGPR 2, ASGP-R 2, ASGPR2, ASGP-R2, asialoglycoprotein receptor 2, CLEC4H2FLJ60040, C-type lectin domain family 4 member H2, HBxAg-binding protein, HBXBP, Hepatic lectin H2, HL-2
• Gene Symbols: ASGR2
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to ASGR2 (asialoglycoprotein receptor 2) The peptide sequence was selected from the N terminal of ASGR2. Peptide sequence STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV.
• Molecular Weight of Antigen: 34 kDa
• Purification Method: Protein A purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Gene ID (Entrez): 433
• Test Specificity: Pig: 77%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Pig
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Form: Purified
• Isotype: IgG

For Research Use Only