Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Asialoglycoprotein Receptor 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP18557925UL
Description
Asialoglycoprotein Receptor 2 Polyclonal specifically detects Asialoglycoprotein Receptor 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Asialoglycoprotein Receptor 2 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
P07307 | |
ASGR2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR | |
25 μL | |
Signal Transduction | |
433 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ASGPR 2, ASGP-R 2, ASGPR2, ASGP-R2, asialoglycoprotein receptor 2, CLEC4H2FLJ60040, C-type lectin domain family 4 member H2, HBxAg-binding protein, HBXBP, Hepatic lectin H2, HL-2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction