ASNA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256050

Catalog No. NBP256050

Description

ASNA1 Polyclonal specifically detects ASNA1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ASNA1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ARSA, arsA arsenite transporter, ATP-binding, homolog 1 (bacterial), ARSA1, ARSA-I, Arsenical pump-driving ATPase, Arsenite-stimulated ATPase, ATPase ASNA1, EC 3.6, EC 3.6.3.16, GET3, golgi to ER traffic 3 homolog, hARSA-I, hASNA-I, MGC3821, Transmembrane domain recognition complex 40 kDa ATPase subunit, transmembrane domain recognition complex, 40kDa, TRC40arsA (bacterial) arsenite transporter, ATP-binding, homolog 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GET3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 439
• Target Species: Human
• Isotype: IgG

For Research Use Only