ASPDH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156824

Catalog No. NBP156824

Description

ASPDH Polyclonal specifically detects ASPDH in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ASPDH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: aspartate dehydrogenase domain containing, Aspartate dehydrogenase domain-containing protein, EC 1.4.1.21, putative L-aspartate dehydrogenase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 554235
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A6ND91
• Gene Symbols: ASPDH
• Immunogen: Synthetic peptides corresponding to LOC554235(hypothetical protein LOC554235) The peptide sequence was selected from the N terminal of LOC554235. Peptide sequence VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Canine: 92%; Guinea pig: 92%; Rat: 92%; Bovine: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG