Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASPDH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ASPDH |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ASPDH Polyclonal specifically detects ASPDH in Human samples. It is validated for Western Blot.Specifications
ASPDH | |
Polyclonal | |
Rabbit | |
A6ND91 | |
554235 | |
Synthetic peptides corresponding to LOC554235(hypothetical protein LOC554235) The peptide sequence was selected from the N terminal of LOC554235. Peptide sequence VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
aspartate dehydrogenase domain containing, Aspartate dehydrogenase domain-containing protein, EC 1.4.1.21, putative L-aspartate dehydrogenase | |
ASPDH | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title