ASPRV1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156511

Catalog No. NBP156511

Description

ASPRV1 Polyclonal specifically detects ASPRV1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ASPRV1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: aspartic peptidase, retroviral-like 1, EC 3.4.23.-, FLJ25084, retroviral-like aspartic protease 1, SASPaseMUNO, SASPTAPS, Skin aspartic protease, Skin-specific retroviral-like aspartic protease, Taps, TPA-inducible aspartic proteinase-like protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%;.
• Target Species: Human, Rat, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53RT3
• Gene Symbols: ASPRV1
• Immunogen: Synthetic peptides corresponding to SASP The peptide sequence was selected from the middle region of SASP. Peptide sequence RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM.
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 151516
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.