Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASPRV1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ASPRV1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ASPRV1 Polyclonal specifically detects ASPRV1 in Human samples. It is validated for Western Blot.Specifications
ASPRV1 | |
Polyclonal | |
Rabbit | |
Q53RT3 | |
151516 | |
Synthetic peptides corresponding to SASP The peptide sequence was selected from the middle region of SASP. Peptide sequence RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
aspartic peptidase, retroviral-like 1, EC 3.4.23.-, FLJ25084, retroviral-like aspartic protease 1, SASPaseMUNO, SASPTAPS, Skin aspartic protease, Skin-specific retroviral-like aspartic protease, Taps, TPA-inducible aspartic proteinase-like protein | |
ASPRV1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title