Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASTE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18029120UL
Description
ASTE1 Polyclonal specifically detects ASTE1 in Mouse samples. It is validated for Western Blot.Specifications
ASTE1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
NP_079927 | |
ASTE1 | |
Synthetic peptide directed towards the middle region of human Aste1. Peptide sequence YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS. | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
asteroid homolog 1 (Drosophila), HT001, MGC129980, protein asteroid homolog 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
28990 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction