Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASTE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ASTE1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180291
![]() |
Novus Biologicals
NBP180291 |
100 μL |
Each for $487.50
|
|
|||||
NB8029120UL
![]() |
Novus Biologicals
NBP18029120UL |
20 μL | N/A | N/A | N/A | ||||
Description
ASTE1 Polyclonal specifically detects ASTE1 in Mouse samples. It is validated for Western Blot.Specifications
ASTE1 | |
Polyclonal | |
Rabbit | |
NP_079927 | |
28990 | |
Synthetic peptide directed towards the middle region of human Aste1. Peptide sequence YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
asteroid homolog 1 (Drosophila), HT001, MGC129980, protein asteroid homolog 1 | |
ASTE1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title