Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP157690

ATAT1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157690 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157690 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157690 Supplier Novus Biologicals Supplier No. NBP157690
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ATAT1 Polyclonal specifically detects ATAT1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ATAT1
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5SQI0
Gene Alias Acetyltransferase MEC-17, alpha tubulin acetyltransferase 1, alpha-TAT, alpha-tubulin N-acetyltransferase, C6orf134, chromosome 6 open reading frame 134, DKFZp547J097, EC 2.3.1.108, Em:AB023049.7, FLJ13158, MEC17Nbla00487, TAT
Gene Symbols ATAT1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ATAT1. The peptide sequence was selected from the N terminal of ATAT1 (NP_079185). Peptide sequence MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL.
Molecular Weight of Antigen 36 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79969
Reconstitution Reconstitute in 100μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.