Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ataxin 1 Antibody (S76-8), Alexa Fluor™ 647, Novus Biologicals™
SDP

Catalog No. NB242186647 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB242186647 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB242186647 Supplier Novus Biologicals Supplier No. NBP242186AF647
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Ataxin 1 Monoclonal specifically detects Ataxin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen Ataxin 1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Monoclonal
Clone S76-8
Conjugate Alexa Fluor 647
Dilution Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Formulation 50mM Sodium Borate with 0.05% Sodium Azide
Gene Alias ataxin 1, ataxin 1), ataxin-1, ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant, SCA1D6S504E, Spinocerebellar ataxia type 1 protein
Gene Symbols ATXN1
Host Species Mouse
Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Purification Method Protein G purified
Quantity 0.1 mL
Research Discipline Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 6310
Test Specificity Detects approx 85kDa.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.