Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ataxin-2 Antibody, Novus Biologicals™

Ataxin-2 Antibody, Novus Biologicals™
SDP

Catalog No. NB418111 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418111 25 μL
NBP190063 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418111 Supplier Novus Biologicals Supplier No. NBP19006325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

Ataxin-2 Polyclonal specifically detects Ataxin-2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Ataxin-2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200-1:500, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ataxin 2, ataxin 2), ataxin-2, ATX2spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, SCA2FLJ46772, Spinocerebellar ataxia type 2 protein, TNRC13, trinucleotide repeat containing 13, Trinucleotide repeat-containing gene 13 protein
Gene Symbols ATXN2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Hematopoietic Stem Cell Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6311
Test Specificity Specificity of human Ataxin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.