Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ATG10 Antibody, Novus Biologicals™

ATG10 Antibody, Novus Biologicals™
SDP

Catalog No. NB396786 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396786 25 μL
NBP238524 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396786 Supplier Novus Biologicals Supplier No. NBP23852425UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

ATG10 Polyclonal specifically detects ATG10 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen ATG10
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9H0Y0
Gene Alias APG10, APG10 autophagy 10-like (S. cerevisiae), APG10L, APG10-like, ATG10 autophagy related 10 homolog (S. cerevisiae), Autophagy-related protein 10, DKFZp586I0418, EC 6.3.2.-, FLJ13954, pp12616, ubiquitin-like-conjugating enzyme ATG10
Gene Symbols ATG10
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: IGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKM
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Autophagy
Primary or Secondary Primary
Gene ID (Entrez) 83734
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.