Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATG7 Rabbit anti-Human, Mouse, Rat, Clone: 3X1W4, Novus Biologicals™
SDP

Catalog No. NB166711 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB166711 100 μg
NB166712 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB166711 Supplier Novus Biologicals Supplier No. NBP315808100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Monoclonal Antibody

ATG7 Monoclonal antibody specifically detects ATG7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen ATG7
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone 3X1W4
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin, Knockout Validated
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias APG7 autophagy 7-like (S. cerevisiae), APG7L, APG7-LIKE, ATG12-activating enzyme E1 ATG7, ATG7 autophagy related 7 homolog (S. cerevisiae), Autophagy-related protein 7, DKFZp434N0735, GSA7, hAGP7, ubiquitin activating enzyme E1-like protein, Ubiquitin-activating enzyme E1-like protein, ubiquitin-like modifier-activating enzyme ATG7
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Autophagy
Primary or Secondary Primary
Gene ID (Entrez) 10533
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.