ATG7 Rabbit anti-Human, Mouse, Rat, Clone: 3X1W4, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31580820UL

Catalog No. NB166712

Description

ATG7 Monoclonal antibody specifically detects ATG7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown

Specifications

• Antigen: ATG7
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
• Clone: 3X1W4
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin, Knockout Validated
• Gene Alias: APG7 autophagy 7-like (S. cerevisiae), APG7L, APG7-LIKE, ATG12-activating enzyme E1 ATG7, ATG7 autophagy related 7 homolog (S. cerevisiae), Autophagy-related protein 7, DKFZp434N0735, GSA7, hAGP7, ubiquitin activating enzyme E1-like protein, Ubiquitin-activating enzyme E1-like protein, ubiquitin-like modifier-activating enzyme ATG7
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
• Quantity: 20 μg
• Research Discipline: Autophagy
• Gene ID (Entrez): 10533
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG