ATG9A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23247725UL

Catalog No. NB437043

Description

ATG9A Polyclonal specifically detects ATG9A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATG9A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: APG9 autophagy 9-like 1, APG9 autophagy 9-like 1 (S. cerevisiae), APG9L1APG9-like 1, ATG9 autophagy related 9 homolog A (S. cerevisiae), autophagy 9-like 1 protein, autophagy-related protein 9A, FLJ22169, mATG9, MGD3208
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ATG9A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
• Quantity: 25 μL
• Research Discipline: Autophagy, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Tumor Suppressors, Ubiquitin Proteasome Pathway
• Gene ID (Entrez): 79065
• Target Species: Human
• Isotype: IgG

For Research Use Only