ATG9A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB437043	Novus Biologicals NBP23247725UL	25 μL
NBP232477	Novus Biologicals NBP232477	0.1 mL

Description

ATG9A Polyclonal specifically detects ATG9A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATG9A
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: APG9 autophagy 9-like 1, APG9 autophagy 9-like 1 (S. cerevisiae), APG9L1APG9-like 1, ATG9 autophagy related 9 homolog A (S. cerevisiae), autophagy 9-like 1 protein, autophagy-related protein 9A, FLJ22169, mATG9, MGD3208
• Gene Symbols: ATG9A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Autophagy, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Tumor Suppressors, Ubiquitin Proteasome Pathway
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 79065
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only