Atlastin-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159016

Catalog No. NBP159016

Description

Atlastin-2 Polyclonal specifically detects Atlastin-2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Atlastin-2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADP-ribosylation factor-like 6 interacting protein 2, ADP-ribosylation factor-like protein 6-interacting protein 2, ADP-ribosylation-like factor 6 interacting protein 2, aip-2, ARL3IP2, ARL-6-interacting protein 2, ARL6IP2, atlastin GTPase 2, atlastin2, atlastin-2, EC 3.6.5.-, FLJ23293
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64225
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NHH9
• Gene Symbols: ATL2
• Immunogen: Synthetic peptides corresponding to ARL6IP2(ADP-ribosylation factor-like 6 interacting protein 2) The peptide sequence was selected from the C terminal of ARL6IP2. Peptide sequence MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Crab-eating macaque: 100%;Atlantic salmon: 91%; Green puffer: 83%; Zebrafish: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only