Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25786725UL
Description
ATM Polyclonal specifically detects ATM in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ATM | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintenance 1, homolog, TELO1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
ATM | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVE | |
25 μL | |
Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Genes Sensitive to DNA Damaging Agents, Hypoxia, Modulation of DNA Pools, p53 Pathway, Tumor Suppressors | |
472 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction